PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1562s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 247aa    MW: 28311.5 Da    PI: 7.5011
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1562s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.13.7e-49141401128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrF+Pt+eelv +yL+ k+ + ++++ +vi+ev+++k++PwdLp      e+e yfFs+++ ky++g+r nra +sg+Wkatg
  SapurV1A.1562s0030.1.p  14 LPPGFRFQPTEEELVFQYLRGKILSWPMPA-SVIPEVNVCKYDPWDLPGD---MEQERYFFSTKEAKYTKGNRVNRASSSGFWKATG 96 
                             79****************************.99***************54...46799***************************** PP

                     NAM  88 kdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk+++s+   ++++vg+kktLvfy+g+ap+g++tdWvmheyrl
  SapurV1A.1562s0030.1.p  97 LDKQIVSStrkNNHAVGMKKTLVFYRGKAPNGSRTDWVMHEYRL 140
                             ******987767777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5510178IPR003441NAC domain
PROSITE profilePS5100554.03914178IPR003441NAC domain
PfamPF023652.7E-2415140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEKFNFVRDG MSRLPPGFRF QPTEEELVFQ YLRGKILSWP MPASVIPEVN VCKYDPWDLP  60
GDMEQERYFF STKEAKYTKG NRVNRASSSG FWKATGLDKQ IVSSTRKNNH AVGMKKTLVF  120
YRGKAPNGSR TDWVMHEYRL VNLGEETTDC NFPQTENSAQ HNSSFQLDKW VVCRIFLKKK  180
GTATAEMTET WTNENDRGAQ PRLFDFMARD DIVFDSVSSS CSSSSNHADV SSNEQDHEQS  240
SSRNFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-451417917166NO APICAL MERISTEM PROTEIN
1ut4_B3e-451417917166NO APICAL MERISTEM PROTEIN
1ut7_A3e-451417917166NO APICAL MERISTEM PROTEIN
1ut7_B3e-451417917166NO APICAL MERISTEM PROTEIN
3swm_A3e-451417920169NAC domain-containing protein 19
3swm_B3e-451417920169NAC domain-containing protein 19
3swm_C3e-451417920169NAC domain-containing protein 19
3swm_D3e-451417920169NAC domain-containing protein 19
3swp_A3e-451417920169NAC domain-containing protein 19
3swp_B3e-451417920169NAC domain-containing protein 19
3swp_C3e-451417920169NAC domain-containing protein 19
3swp_D3e-451417920169NAC domain-containing protein 19
4dul_A3e-451417917166NAC domain-containing protein 19
4dul_B3e-451417917166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043026.11e-143PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY938e-73NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB9I3W71e-141B9I3W7_POPTR; Uncharacterized protein
STRINGPOPTR_0012s10530.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-73NAC domain containing protein 83